Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human IFN-gamma, His TagProduct Specification Species Human Accession P01579 Amino Acid Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 18. 5 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4 Reconstitution
Product Specification
| Species | Human |
| Accession | P01579 |
| Amino Acid Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 18.5 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
IFN-gamma, the only member of type II interferon, is a soluble dimer cytokine secreted mainly by natural killer cells (NK) and natural killer T cells (NKT) when it functions in innate immunity. During antigen-specific immunity it is secreted by CD4 Th1 and CD8 cytotoxic T cells.IFN-gamma acts on the whole process of tumorigenesis and development, and its anti-tumor mechanism is mainly divided into immune mechanism and non-immune mechanism.IFN-gamma can directly inhibit tumor cell proliferation, promote tumor cell apoptosis, inhibit tumor angiogenesis, and cooperate with NK, NKT, γδT cells and CD4+/CD8+T cells of innate and adaptive immunity to complete tumor killing. In addition, IFN-gamma also has an important immunomodulatory function, which can improve the lysosomal activity of macrophages, and has an anti-proliferation effect on transformed cells.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy