SKU: 15423015031

ASFV p54, His tag

Sale price$40.50 Regular price$45.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ASFV p54, His tagProduct Specification Species African Swine Fever Synonyms pE183L Accession Q65194 Amino Acid Sequence Protein sequence(Q65194 Ser54 Leu183, with C 10*His) SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 15. 5kDa Actual: 20kDa Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species African Swine Fever
Synonyms pE183L
Accession Q65194
Amino Acid Sequence

Protein sequence(Q65194 Ser54-Leu183, with C-10*His)
SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:15.5kDa Actual: 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

African swine fever (ASF) is a highly lethal hemorrhagic viral disease of swine that usually results to a mortality rate approaching 100% in domestic pigs and is classified as a notifiable disease by the World Organization for Animal Health (OIE). A number of studies have reported that p54 is one of the most important ASFV proteins and plays a key role in virus morphogenesis and viral infection. Anti-p54 sera were found to inhibit ASFV attachment to susceptible cells, suggesting its role in virus entry. Similarly, p54/E183L gene plays an essential role in virus viability and recruitment of envelop precursors to assembly sites. Most importantly, E183L gene is crucial for virus particle transporting to perinuclear factory via direct binding to light chain 8 (LC8) of the dynein. A short p54 peptide (149–161 aa) near to its C-terminus is enough to bind to dynein light chain 8 (DLC8) and act as a cargo transport for virus particle.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15423015031

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 447 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
A. S.
Belleville, US
★★★★★ 5
Perfect
Color: A.Beige
I had some jewelry I wanted to gift to mt niece and needed something to send it in. This was a lovely little box, great for travel or sending jewelry in. It was well made, had ample space for different pieces of jewelry and made a really nice little presentation box, imo. It's something she can use regularly on for a trip. I liked it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
I
Verified Purchase
Irina
Natrona Heights, US
★★★★★ 4
Perfect for Travel
Color: A.Beige
Perfect to keep everything organized on the go! Compact but it fits everything you need. Quality is good and the color is ok. Great addition to the travel must haves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
M
Verified Purchase
Melissa
Omaha, US
★★★★★ 5
Must have for travel!
Color: B.Pink
Perfect size for travel and holds everything I need it to! So cute and I love it. Such a good buy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
A
Verified Purchase
Amazon Customer
Draper, US
★★★★★ 5
Quaiity and the perfect size!
Color: A.Beige
Item arrived very quickly and was as described. It is the perfect travel size or for the top of the dresser.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
C
Verified Purchase
Cecily
Charlottesville, US
★★★★★ 5
Smaller than it looks but worth it.
Color: A.Beige, Color: A.Beige
Cute and small. Definitely good for traveling.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026

recommand products