SKU: 50602339356

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms Gal 3, 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding protein, L 31, Laminin binding protein, Lectin L 29, Mac 2 antigen, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Met1 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms Gal-3, 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding protein, L-31, Laminin-binding protein, Lectin L-29, Mac-2 antigen, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Met1-Ile250, with C-10*His)
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:27.8kDa Actual:35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50602339356

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 568 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Karla ayonAmazon
Waukegan, US
★★★★★ 5
So good
Great product, very moisturizing and smells really good. Kinda strong but goes away after a few minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
R
Verified Purchase
Rachel R
Whiting, US
★★★★★ 5
Fantastic Product
Most lip balms, chapsticks, lipstick etc will make my skin peel off. I don't get moisture and I end up with chapped lips and open cuts. But since this is so natural it fixed my problem. What's nice is I don't get that gunk buildup on the side of the mouth with white stuff either. This lip balm is very smooth, very hydrating and it smells like dessert. It's gonna be my go-to forever and ever.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2024
T
Verified Purchase
tkeef
Battle Creek, US
★★★★★ 3
More cinnamon flavor than vanilla
I really wanted to like this lip balm but, as another person commented, the cinnamon flavor dominates. It does moisturize quite well if you can overlook how spicy the cinnamon tastes. Would have preferred just plain vanilla instead. Not sure I'll keep this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
M
Verified Purchase
Mandi
Natrona Heights, US
★★★★★ 4
hot cinnamon
Only had this one day and I do like it but would like to note the cinnamon is more like hot tamale cinnamon not cinnamon roll cinnamon. still does the job but my chapped lips give a good burn for maybe 30 sec :( going to check if they have another flavor option for next order
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2025
M
Verified Purchase
me
West Palm Beach, US
★★★★★ 5
Best lip balm I’ve found yet
Every lip balm or chapstick I have ever used has always bothered my lips and made them peel. I’ve tried cheap chapsticks to organic chapsticks to vegan and nothing has ever worked. I figured I’d give this a try since I didn’t have much to lose and I am SO glad I did. This is the first lip balm that hasn’t made my lips peel. I LOVE THIS. And the cinnamon vanilla smells divine. This is definitely going to be my go to from now on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2024

recommand products