SKU: 3002578329

CCoV N protein , His tag

Sale price$40.50 Regular price$45.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CCoV N protein , His tagProduct Specification Synonyms 5' nucleotidase (5' NT), Acid phosphatase 3, Ecto 5' nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP Accession Q7T6S8 Amino Acid Sequence Protein sequence(Q7T6S8, Met1 Asn382, with C 10*His)

Product Specification


Synonyms 5'-nucleotidase (5'-NT), Acid phosphatase 3, Ecto-5'-nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP
Accession Q7T6S8
Amino Acid Sequence

Protein sequence(Q7T6S8, Met1-Asn382, with C-10*His)
MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPVTLKQGSKFWDLCPRDFVPLKIGNKDQQIGYWNRQIRYRMVKGQRKDLPERWFFYYLGTGPHADAKFKQKLDGVVWVAKEGAMTKPTTLGTRGTNNESKALKFDVKVPSEFQLEVNQSRDNSRSRSQSRSQSRTRAQSRGRQQSNNKKDDSVEQAVLAALKKLGVDTEKQQQRARSKSKERSNSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSSSANFGDSDLVANGNSAKHYPQLAECVPSVSSILFGSHWTAKEDGDQIEVTFTHKYHLPKDDPKTGQFLQQINAYARPSEVAKEQRLRKARSKSAERVEQEVVPDALTENYTDVFDDTQVEIIDEVTNGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 45.1kDa Actual: 50kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

The nucleocapsid (N) protein is a protein that packages the positive-sense RNA genome of coronaviruses to form ribonucleoprotein structures enclosed within the viral capsid. The N protein is the most highly expressed of the four major coronavirus structural proteins. In addition to its interactions with RNA, N forms protein-protein interactions with the coronavirus membrane protein (M) during the process of viral assembly. N also has additional functions in manipulating the cell cycle of the host cell.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3002578329

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1181 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Javier Garcia
Belleville, US
★★★★★ 5
Great Phone Holder
Style: Holder+Dash+Vent+Windshield
I bought the version with the suction cup mount and I’m very happy with it. It holds my phone securely in place and doesn’t move around while driving. It’s also very easy to place the phone in the holder and remove it when needed. The suction cup sticks well to the dashboard, and you can position it so the phone stays in a safe, easy-to-see spot while driving. Overall, a great and reliable phone mount. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
P
Verified Purchase
Paul N. Gallegos
Birmingham, US
★★★★★ 5
Secure Fit, great hold
Very solid fit, doesn't wobble or shift positions while driving even on very bumpy roads. Magnet is very strong and sturdy, once phone is in position it's not going anywhere unless you remove it. Great product especially for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
N
Verified Purchase
norCal Dan
Battle Creek, US
★★★★★ 5
exactly what i needed
I wanted to add to my original review 6 months ago This little mount has stayed on my Model X for 6 months now and it works GREAT! Very sturdy and the magnet locks on immediately every time I drive. it's handy on the top left of my screen for a WAZE map to be alerted for those issues on the road whenever I'm on a long drive. I'm really happy with it and I bought another one for my coworker's birthday. Uploading another video. I would highly recommend. ------- This mount for my Tesla is exactly what i needed for my road trip. I really don't need it to wireless charge as cable are faster anyway. Pros: - Very easy to install. doesn't test my IQ with all the unnecessary instructions. - NO NEED for 3M stickie adhesive on my car. I just simply don't want this in my car! Bad experience in the past and I'll return anything that needs to uses a 3M adhesive. - Very strong magnet grip. Bought it right before my 10 hour road trip, no issues at all. - connects to the top 2 angles on my model X, I will likely buy another mount for the passenger seat. It will also work with the bottom angle when I tilt the screen out. - And it seem to be able to bypass the Tesla cabin camera during AP/FSD. Down sides: - it would be great if it can also charge- however i would not want a cable dangling to the 12v port./ - price is a bit on the high side
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2024
B
Verified Purchase
Brenda Ruiz
Battle Creek, US
★★★★★ 3
Falls regularly
It works for a bit but falls from my screen on a very regular basis no matter how tight I tighten it or what position the phone is in. The magnet it strong, but the mount itself doesn’t hold on to the screen where it’s supposed to.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
D
Verified Purchase
Dmitriy Perlin
Louisville, US
★★★★★ 5
Great mount
Really like this mount: Very versatile, no glue
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026

recommand products