SKU: 95702989457

Mouse TMEM119 , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse TMEM119 , His tagProduct Specification Species Mouse Synonyms Osteoblast induction factor (OBIF) Accession Q8R138 Amino Acid Sequence Protein sequence(Q8R138, Thr100 Val280, with C 10*His) TFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 20. 8kDa Actual: 28kDa Purity

Product Specification


Species Mouse
Synonyms Osteoblast induction factor (OBIF)
Accession Q8R138
Amino Acid Sequence

Protein sequence(Q8R138, Thr100-Val280, with C-10*His)

TFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:20.8kDa Actual: 28kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

TMEM119 is known as a microglia-specific and robustly expressed trans-membranous molecule, which is not expressed by other macrophages and immune or neuronal cells, and forms, therefore, the most promising microglia marker to date. TMEM119 has served as a reliable immunohistochemical microglia marker for neurodegenerative diseases since then and was recently stained by an adapted protocol for immunocytochemistry even in postmortem CSF samples of trauma cases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95702989457

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 1561 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
sharpmark
Lake Worth, US
★★★★★ 1
Junk.
Color: Brown/Black
Junk watch. Arrived not working. Tried to get Timex support to help,but they put the ones on Amazon. We all know how that turned out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
K
Verified Purchase
kkrome25
Massapequa, US
★★★★★ 5
Understated Style
Color: Brown/Black
I prefer Timex over Casio because of their superior aesthetics. Timex watches have never failed me. This model fits smaller men's wrists around 6 inches in diameter, and the watch face is the right size. The black face with white numbers is easy to read. The metallic body looks awesome with the brown leather band. I wish they made one with a white face. The storage battery holds up very well when there is no sun. Accuracy is excellent. This is a very presentable and versatile watch for informal wear and business casual situations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 10, 2025
M
Verified Purchase
Max
Massapequa, US
★★★★★ 3
Quality and Reliability - Hit or Miss
Color: Brown
Update: I went ahead and bought this watch again. Like many other Timex watches I’ve had in the past, the first one was faulty but I decided to roll the dice again. I needed a beater solar watch for when I go hiking, camping, etc. There are several options out there—Vaer, Casio, Citizen. I liked the look of Vaer, but their solar offerings are overpriced, IMO. The Citizen watches priced similarly to this Timex are too big and don’t offer sapphire. Casio’s analog watches have the same issue. There is their Edifice watch, but I don’t like integrated bracelets. So Timex it is again. 36mm, sapphire, solar powered, 100m water resistant, a field watch, it has what I'm looking for. And this second time around, it's been good so far— it's been reliable and accurate. So, it’s the luck of the draw with these watches. It’s one of the more attractive Timex watches, too. If I hadn't had a prior bad experience with this watch, I would give it 5 stars. But due to the inconsistency in quality, I can’t rate it higher than 3 stars. Original review: I wanted to add a solar powered watch to my collection. So, after some research, I decided to buy this one. It had great specs—sapphire crystal, 100m water resistance, solar powered (of course), looked good in pictures. A perfect grab-and-go-anywhere watch. It was love at first sight when I got this watch; It was seeming like a great bang-for-buck product… That is, until I looked at it as a timekeeping device—its primary purpose. I compared it to my other watches and noticed it was 4 seconds behind. I thought maybe I had set the time wrong, so I corrected it. A few days passed, and again it was several seconds behind. I repeated this process a few more times, same results. So here’s the problem: this watch doesn’t keep good time. More specifically… This QUARTZ watch doesn’t keep good time. Derided by watch collectors as having no soul, accuracy is a quartz watch’s most redeeming quality. It may lack soul, but you can’t say it doesn’t excel at timekeeping; it wipes the floor with mechanical watches in that department. But this quartz watch doesn’t do that. At least the one I got didn’t do that; your results may vary. But this is the third Timex in a row that I’ve bought that cost over $100 that had some kind of major defect… Three times in a row.. I can’t rationalize buying a Timex anymore. At least not at the higher price range. Luckily, Amazon has a good return policy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2024
K
Verified Purchase
Kaleris
Massapequa, US
★★★★★ 5
Very versatile
Color: Brown/Black
Fantastic watch, as long as it's exposed to some light will never run out. I have expensive watches as well, but I end up coming back to this one frequently as it's dressy enough, and small enough to fit well under motorcycle gloves. Sapphire glass at this price point is really great as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025
B
Verified Purchase
Beatriz Hernandez
Louisville, US
★★★★★ 5
Camisa
Espectacular tela y ajusta perfecto a la taya
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026

recommand products