SKU: 54071054747

Human IL-6,His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6,His tagProduct Specification Species Human Synonyms B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2),IFNB2 Accession P05231 Amino Acid Sequence Protein sequence(P05231, Val30 Met212, with C 10*His)

Product Specification


Species Human
Synonyms B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2),IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:22.4kDa Actual:20-23kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. In addition, osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54071054747

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1933 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Anum Jawed
Natrona Heights, US
★★★★★ 5
Highly recommended
Size: X-Large, Color: White
Excellent fabric, style and true to size👍👍👍my husband loved it👍👍highly recommended👍👍
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
V
Verified Purchase
Vijay
Lowell, US
★★★★★ 5
Happy purchase
Size: XX-Large, Color: Black
This kurta arrived on time, in a clean and air sealed wrap. The material is soft as described, the design matches, and size matches what I was looking for. This was very comfortable to wear and I’ll be purchasing more from this brand of different colors. Great buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2025
T
Verified Purchase
Tammy
Port Orchard, US
★★★★★ 5
Really nice sweater gift
I bought this for my husband. It fit him very well. I went up a size for a more comfortable fit for him. This sweater is well made and the quality is great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
F
Verified Purchase
Frank F.
Waukegan, US
★★★★★ 5
I couldn't be happier
The quality is very good looks great on very happy with the style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
J
Verified Purchase
James
Birmingham, US
★★★★★ 4
Thin, but dont let that stop you from buying.
Soft, looks nice, and im a fan in general. The things i do want to address is that its pretty thin fabric, and that even when i ordered the smallest size it was just a tad to big all around. Decent enough for the money tho.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 5, 2025

recommand products