SKU: 21951038540

Human PTH , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 11. 1kDa Actual: 10, 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Parathormone, Parathyrin
Accession P01270
Amino Acid Sequence

Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:11.1kDa Actual:10, 12kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21951038540

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 326 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
NK
Carnegie, US
★★★★★ 5
Stops Me From Picking and Actually Works
As a woman in my 40s, I never would have guessed I’d still need pimple patches, yet the occasional zit still pops up — and these things are like magic. They work really well, blend into my fair/light skin nicely, and are barely noticeable at a quick glance. I’m also a terrible picker, and picking is so bad for your skin, so I love that these keep me from messing with pimples while doing all the work for me overnight. I’m always grossly fascinated by how much gunk they pull out by morning. Very happy to have these in my little skincare emergency arsenal.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
E
Elis
Charlottesville, US
★★★★★ 5
Camouflages well with the skin and sticks long enough
I was excited to try these Halo Dot patches because I was having some breakouts before a wedding I had to attend. I put these on three nights before the wedding only at nights and left them on until the morning. I washed my face the 1st night, yet the second night I did not and it still attached (mind that I have a very oily face by the end of the day). With every application I saw good results as the breakouts were being reduced with each use. It is easy to put on and to carry out if you need to travel because it comes in two separate little envelope like package that you can put in a backpack/purse. These are thin and are almost not visible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
B
Beachcomber
Draper, US
★★★★★ 4
Easy to Use and Surprisingly Effective
Even though I am well past the age when I thought breakouts would stop happening, I still get the occasional pimple. As luck would have it, I felt one starting to pop up on my cheek the day after these Halo Dot Pimple Patches arrived. Before bed, after washing and thoroughly drying my face, I applied one of the patches. It peeled easily from the backing sheet, and when I realized I had not placed it quite right, I was pleasantly surprised that I could lift and reposition it without any trouble. What really impressed me was how well it blended into my skin. I was only wearing it overnight, but honestly, I do not think anyone would have noticed it unless they were looking very closely. In fact, I forgot I even had it on until I looked in the mirror the next morning. The patch peeled off easily and had clearly pulled some of the buildup from the blemish overnight. There was no redness or irritation afterward, and the spot looked dramatically improved by morning. The only downside for me is the price, especially since the package contains just 33 patches. That said, if they continue to work this well, I would definitely consider purchasing them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
S
Summerr
Natrona Heights, US
★★★★★ 5
Love these already! Came in handy just when I need it!
These acne patches came in really handy when I had a random breakout near my lip, especially since that’s an area where I tend to wear a lot of makeup. They helped gently draw out impurities without being harsh on my skin. I also like that they blend in well on the skin. They’re not tinted, but they still work nicely across different skin tones like advertised, which makes them less noticeable while wearing them. You get a good amount in the package as well—33 patches total, with 18 patches on each sheet. Overall, they’re convenient to have on hand for unexpected breakouts, and I would definitely recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
N
Verified Purchase
Nancy
New York, US
★★★★★ 5
Will purchase again
Size: 6 in, Color: Blue
Dogs love this. Chew-on-able, and durable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products