SKU: 17110938049

Human ATF4 , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ATF4 , His tagProduct Specification Species Human Synonyms Activating transcription factor 4, Cyclic AMP responsive element binding protein 2, CREB 2, cAMP responsive element binding protein 2, Tax responsive enhancer element binding protein 67, TaxREB67, TXREB Accession P18848 Amino Acid Sequence Protein sequence(P18848, Phe20 Tyr200, with C 10*His)

Product Specification


Species Human
Synonyms Activating transcription factor 4, Cyclic AMP-responsive element-binding protein 2, CREB-2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, TaxREB67, TXREB
Accession P18848
Amino Acid Sequence

Protein sequence(P18848, Phe20-Tyr200, with C-10*His) FDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:21.4kDa Actual:29kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Activating transcription factor 4 (tax-responsive enhancer element B67), also known as ATF4, is a protein that in humans is encoded by the ATF4 gene. This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). ATF4 is not a functional transcription factor by itself but one-half of many possible heterodimeric transcription factors. ATF4 belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. ATF4 transcription factor is also known to play role in osteoblast differentiation along with RUNX2 and osterix.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17110938049

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1515 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Karla ayonAmazon
Lowell, US
★★★★★ 5
So good
Great product, very moisturizing and smells really good. Kinda strong but goes away after a few minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
R
Verified Purchase
Rachel R
Fort Morgan, US
★★★★★ 5
Fantastic Product
Most lip balms, chapsticks, lipstick etc will make my skin peel off. I don't get moisture and I end up with chapped lips and open cuts. But since this is so natural it fixed my problem. What's nice is I don't get that gunk buildup on the side of the mouth with white stuff either. This lip balm is very smooth, very hydrating and it smells like dessert. It's gonna be my go-to forever and ever.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2024
T
Verified Purchase
tkeef
Phoenix, US
★★★★★ 3
More cinnamon flavor than vanilla
I really wanted to like this lip balm but, as another person commented, the cinnamon flavor dominates. It does moisturize quite well if you can overlook how spicy the cinnamon tastes. Would have preferred just plain vanilla instead. Not sure I'll keep this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
M
Verified Purchase
Mandi
Draper, US
★★★★★ 4
hot cinnamon
Only had this one day and I do like it but would like to note the cinnamon is more like hot tamale cinnamon not cinnamon roll cinnamon. still does the job but my chapped lips give a good burn for maybe 30 sec :( going to check if they have another flavor option for next order
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2025
M
Verified Purchase
me
Boise, US
★★★★★ 5
Best lip balm I’ve found yet
Every lip balm or chapstick I have ever used has always bothered my lips and made them peel. I’ve tried cheap chapsticks to organic chapsticks to vegan and nothing has ever worked. I figured I’d give this a try since I didn’t have much to lose and I am SO glad I did. This is the first lip balm that hasn’t made my lips peel. I LOVE THIS. And the cinnamon vanilla smells divine. This is definitely going to be my go to from now on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2024

recommand products